![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
![]() | Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (11 PDB entries) Uniprot P62837 E2-17 kDa 2 |
![]() | Domain d1w4ua_: 1w4u A: [114194] |
PDB Entry: 1w4u (more details)
SCOPe Domain Sequences for d1w4ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w4ua_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv peiariyktdrekynriarewtqkyam
Timeline for d1w4ua_: