Lineage for d1w4ua_ (1w4u A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407061Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (10 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 1407070Domain d1w4ua_: 1w4u A: [114194]

Details for d1w4ua_

PDB Entry: 1w4u (more details)

PDB Description: nmr solution structure of the ubiquitin conjugating enzyme ubch5b
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2-17 kda 2

SCOPe Domain Sequences for d1w4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ua_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d1w4ua_:

Click to download the PDB-style file with coordinates for d1w4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1w4ua_: