SCOP 1.75: Domain d1w4ma_: 1w4m A:

Lineage for d1w4ma_ (1w4m A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.31: DEP domain [63483] (4 proteins)
   membrane-binding domain

6. Protein Pleckstrin [101039] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116790] (2 PDB entries)
   Uniprot P08567 125-219 # structure of the N-terminal PH domain (1-105) is also known ((50741))

8. Domain d1w4ma_: 1w4m A: [114193]

Details for d1w4ma_

PDB Entry: 1w4m

PDB Description: structure of the human pleckstrin dep domain by multidimensional nmr

PDB Compounds: (A:) Pleckstrin

SCOP Domain Sequences for d1w4ma_:

Sequence; same for both SEQRES and ATOM records:

>d1w4ma_ a.4.5.31 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
dlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrqeglmiassl
lnegylqpagdmsksavdgtaenpfldnpdafyyf

Timeline for d1w4ma_:

• d1w4ma_ first appeared in SCOP 1.71
  
• d1w4ma_ appears in SCOP 1.73
  
• d1w4ma_ appears in SCOPe 2.01
  
• d1w4ma_ appears in the current release, SCOPe 2.08