Lineage for d1w4ma_ (1w4m A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693893Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2693894Protein Pleckstrin [101039] (2 species)
  7. 2693895Species Human (Homo sapiens) [TaxId:9606] [116790] (2 PDB entries)
    Uniprot P08567 125-219 # structure of the N-terminal PH domain (1-105) is also known (50741)
  8. 2693897Domain d1w4ma_: 1w4m A: [114193]

Details for d1w4ma_

PDB Entry: 1w4m (more details)

PDB Description: structure of the human pleckstrin dep domain by multidimensional nmr
PDB Compounds: (A:) Pleckstrin

SCOPe Domain Sequences for d1w4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ma_ a.4.5.31 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
dlgalylsmkdtekgikelnlekdkkifnhcftgncvidwlvsnqsvrnrqeglmiassl
lnegylqpagdmsksavdgtaenpfldnpdafyyf

SCOPe Domain Coordinates for d1w4ma_:

Click to download the PDB-style file with coordinates for d1w4ma_.
(The format of our PDB-style files is described here.)

Timeline for d1w4ma_: