![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein NTPase P4 [117541] (1 species) contains extra N-terminal subdomain (~100 residues): [contains pseudo beta-barrel] |
![]() | Species Bacteriophage phi-12 [TaxId:161736] [117542] (10 PDB entries) Uniprot Q94M05 |
![]() | Domain d1w47c_: 1w47 C: [114155] protein/RNA complex; complexed with adp, mn has additional subdomain(s) that are not in the common domain |
PDB Entry: 1w47 (more details), 2.5 Å
SCOPe Domain Sequences for d1w47c_:
Sequence, based on SEQRES records: (download)
>d1w47c_ c.37.1.11 (C:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts
>d1w47c_ c.37.1.11 (C:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts
Timeline for d1w47c_: