Lineage for d1w46c_ (1w46 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869857Protein NTPase P4 [117541] (1 species)
    contains extra N-terminal subdomain (~100 residues): [contains pseudo beta-barrel]
  7. 2869858Species Bacteriophage phi-12 [TaxId:161736] [117542] (10 PDB entries)
    Uniprot Q94M05
  8. 2869909Domain d1w46c_: 1w46 C: [114152]
    protein/RNA complex; complexed with adp, mg
    has additional subdomain(s) that are not in the common domain

Details for d1w46c_

PDB Entry: 1w46 (more details), 2.7 Å

PDB Description: p4 protein from bacteriophage phi12 in complex with adp and mg
PDB Compounds: (C:) ntpase p4

SCOPe Domain Sequences for d1w46c_:

Sequence, based on SEQRES records: (download)

>d1w46c_ c.37.1.11 (C:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}
mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
kivelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts

Sequence, based on observed residues (ATOM records): (download)

>d1w46c_ c.37.1.11 (C:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}
mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihts

SCOPe Domain Coordinates for d1w46c_:

Click to download the PDB-style file with coordinates for d1w46c_.
(The format of our PDB-style files is described here.)

Timeline for d1w46c_: