SCOPe 2.06: Domain d1w3hb_: 1w3h B:

Lineage for d1w3hb_ (1w3h B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
   Uniprot P14768 265-610

8. Domain d1w3hb_: 1w3h B: [114141]
   complexed with ca, edo; mutant

Details for d1w3hb_

PDB Entry: 1w3h, 1.5 Å

PDB Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus

PDB Compounds: (B:) endo-1,4-beta-xylanase a precursor

SCOPe Domain Sequences for d1w3hb_:

Sequence; same for both SEQRES and ATOM records:

>d1w3hb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr

Timeline for d1w3hb_:

• d1w3hb_ first appeared in SCOP 1.71
  
• d1w3hb_ appears in SCOPe 2.05
  
• d1w3hb_ appears in SCOPe 2.07
  
• d1w3hb_ appears in the current release, SCOPe 2.08