![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Xylanase A, catalytic core [51514] (8 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries) Uniprot P14768 265-610 |
![]() | Domain d1w3hb_: 1w3h B: [114141] complexed with ca, edo; mutant |
PDB Entry: 1w3h (more details), 1.5 Å
SCOPe Domain Sequences for d1w3hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3hb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft nsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr
Timeline for d1w3hb_: