Lineage for d1w3hb_ (1w3h B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831125Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2831151Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
    Uniprot P14768 265-610
  8. 2831161Domain d1w3hb_: 1w3h B: [114141]
    complexed with ca, edo; mutant

Details for d1w3hb_

PDB Entry: 1w3h (more details), 1.5 Å

PDB Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus
PDB Compounds: (B:) endo-1,4-beta-xylanase a precursor

SCOPe Domain Sequences for d1w3hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3hb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsgr

SCOPe Domain Coordinates for d1w3hb_:

Click to download the PDB-style file with coordinates for d1w3hb_.
(The format of our PDB-style files is described here.)

Timeline for d1w3hb_: