Lineage for d1w3ha_ (1w3h A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094224Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2094250Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
    Uniprot P14768 265-610
  8. 2094261Domain d1w3ha_: 1w3h A: [114140]
    complexed with ca, edo; mutant

Details for d1w3ha_

PDB Entry: 1w3h (more details), 1.5 Å

PDB Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus
PDB Compounds: (A:) endo-1,4-beta-xylanase a precursor

SCOPe Domain Sequences for d1w3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ha_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
spglasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfs
ftnsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagq
vkswdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyy
ndfnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsp
tlkikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgr
rggitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

SCOPe Domain Coordinates for d1w3ha_:

Click to download the PDB-style file with coordinates for d1w3ha_.
(The format of our PDB-style files is described here.)

Timeline for d1w3ha_: