Lineage for d1w36f3 (1w36 F:818-1121)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994758Family c.52.1.25: Exodeoxyribonuclease V beta chain (RecC), C-terminal domain [117622] (1 protein)
    related to the RecB domain
  6. 994759Protein Exodeoxyribonuclease V beta chain (RecC), C-terminal domain [117623] (1 species)
  7. 994760Species Escherichia coli [TaxId:562] [117624] (1 PDB entry)
    Uniprot P07648
  8. 994762Domain d1w36f3: 1w36 F:818-1121 [114135]
    Other proteins in same PDB: d1w36b1, d1w36b2, d1w36b3, d1w36c1, d1w36c2, d1w36d1, d1w36d2, d1w36e1, d1w36e2, d1w36e3, d1w36f1, d1w36f2, d1w36g1, d1w36g2
    protein/DNA complex; complexed with ca

Details for d1w36f3

PDB Entry: 1w36 (more details), 3.1 Å

PDB Description: recbcd:dna complex
PDB Compounds: (F:) exodeoxyribonuclease v gamma chain

SCOPe Domain Sequences for d1w36f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w36f3 c.52.1.25 (F:818-1121) Exodeoxyribonuclease V beta chain (RecC), C-terminal domain {Escherichia coli [TaxId: 562]}
sefvqplpftlpetvpletlqrfwahpvraffqmrlqvnfrtedseipdtepfileglsr
yqinqqllnalveqddaerlfrrfraagdlpygafgeifwetqcqemqqladrviacrqp
gqsmeidlacngvqitgwlpqvqpdgllrwrpsllsvaqgmqlwlehlvycasggngesr
lflrkdgewrfpplaaeqalhylsqliegyregmsapllvlpesggawlktcydaqndam
ldddstlqkartkflqayegnmmvrgegddiwyqrlwrqltpetmeaiveqsqrfllplf
rfnq

SCOPe Domain Coordinates for d1w36f3:

Click to download the PDB-style file with coordinates for d1w36f3.
(The format of our PDB-style files is described here.)

Timeline for d1w36f3: