![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain [117552] (1 species) each AAA domain contains an all-alpha insert subdomain |
![]() | Species Escherichia coli [TaxId:562] [117553] (1 PDB entry) Uniprot P07648 |
![]() | Domain d1w36f1: 1w36 F:1-347 [114133] Other proteins in same PDB: d1w36b1, d1w36b2, d1w36b3, d1w36c3, d1w36d1, d1w36d2, d1w36e1, d1w36e2, d1w36e3, d1w36f3, d1w36g1, d1w36g2 protein/DNA complex; complexed with ca has additional subdomain(s) that are not in the common domain |
PDB Entry: 1w36 (more details), 3.1 Å
SCOPe Domain Sequences for d1w36f1:
Sequence, based on SEQRES records: (download)
>d1w36f1 c.37.1.19 (F:1-347) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} mlrvyhsnrldvlealmefivererlddpfepemilvqstgmaqwlqmtlsqkfgiaani dfplpasfiwdmfvrvlpeipkesafnkqsmswklmtllpqlleredftllrhyltddsd krklfqlsskaadlfdqylvyrpdwlaqwetghlveglgeaqawqaplwkalveythqlg qprwhranlyqrfietlesattcppglpsrvficgisalppvylqalqalgkhieihllf tnpcryywgdikdpaylaklltrqrrhsfedrelplfrdsenagqlfnsdgeqdvgnpll aswgklgrdyiyllsdlessqeldafvdvtpdnllhniqsdilelen
>d1w36f1 c.37.1.19 (F:1-347) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} mlrvyhsnrldvlealmefivererlddpfepemilvqstgmaqwlqmtlsqkfgiaani dfplpasfiwdmfvrvlpeipkesafnkqsmswklmtllpqlleredftllrhyltddsd krklfqlsskaadlfdqylvyrpdwlaqwetghlveglgeaqawqaplwkalveythqlg qprwhranlyqrfietlesattcppglpsrvficgisalppvylqalqalgkhieihllf tnpcryywgdvgnpllaswgklgrdyiyllsdlessqeldafvdvtpdnllhniqsdile len
Timeline for d1w36f1: