![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families) ![]() |
![]() | Family c.52.1.25: Exodeoxyribonuclease V beta chain (RecC), C-terminal domain [117622] (1 protein) related to the RecB domain |
![]() | Protein Exodeoxyribonuclease V beta chain (RecC), C-terminal domain [117623] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117624] (1 PDB entry) |
![]() | Domain d1w36c3: 1w36 C:818-1121 [114127] Other proteins in same PDB: d1w36b1, d1w36b2, d1w36b3, d1w36c1, d1w36c2, d1w36d1, d1w36d2, d1w36e1, d1w36e2, d1w36e3, d1w36f1, d1w36f2, d1w36g1, d1w36g2 |
PDB Entry: 1w36 (more details), 3.1 Å
SCOP Domain Sequences for d1w36c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w36c3 c.52.1.25 (C:818-1121) Exodeoxyribonuclease V beta chain (RecC), C-terminal domain {Escherichia coli [TaxId: 562]} sefvqplpftlpetvpletlqrfwahpvraffqmrlqvnfrtedseipdtepfileglsr yqinqqllnalveqddaerlfrrfraagdlpygafgeifwetqcqemqqladrviacrqp gqsmeidlacngvqitgwlpqvqpdgllrwrpsllsvaqgmqlwlehlvycasggngesr lflrkdgewrfpplaaeqalhylsqliegyregmsapllvlpesggawlktcydaqndam ldddstlqkartkflqayegnmmvrgegddiwyqrlwrqltpetmeaiveqsqrfllplf rfnq
Timeline for d1w36c3: