Lineage for d1w36b3 (1w36 B:899-1174)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490532Family c.52.1.24: Exodeoxyribonuclease V beta chain (RecB), C-terminal domain [117619] (1 protein)
    related to the RecC domain
  6. 2490533Protein Exodeoxyribonuclease V beta chain (RecB), C-terminal domain [117620] (1 species)
  7. 2490534Species Escherichia coli [TaxId:562] [117621] (1 PDB entry)
    Uniprot P08394
  8. 2490535Domain d1w36b3: 1w36 B:899-1174 [114124]
    Other proteins in same PDB: d1w36b1, d1w36b2, d1w36c1, d1w36c2, d1w36c3, d1w36d1, d1w36d2, d1w36e1, d1w36e2, d1w36f1, d1w36f2, d1w36f3, d1w36g1, d1w36g2
    protein/DNA complex; complexed with ca

Details for d1w36b3

PDB Entry: 1w36 (more details), 3.1 Å

PDB Description: recbcd:dna complex
PDB Compounds: (B:) exodeoxyribonuclease v beta chain

SCOPe Domain Sequences for d1w36b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w36b3 c.52.1.24 (B:899-1174) Exodeoxyribonuclease V beta chain (RecB), C-terminal domain {Escherichia coli [TaxId: 562]}
dnwrvtsysglqqrghgiaqdlmprldvdaagvasvveeptltphqfprgaspgtflhsl
fedldftqpvdpnwvreklelggfesqwepvltewitavlqaplnetgvslsqlsarnkq
vemefylpisepliasqldtlirqfdplsagcpplefmqvrgmlkgfidlvfrhegryyl
ldyksnwlgedssaytqqamaaamqahrydlqyqlytlalhrylrhriadydyehhfggv
iylflrgvdkehpqqgiyttrpnaglialmdemfag

SCOPe Domain Coordinates for d1w36b3:

Click to download the PDB-style file with coordinates for d1w36b3.
(The format of our PDB-style files is described here.)

Timeline for d1w36b3: