Lineage for d1w32b_ (1w32 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571750Protein Xylanase A, catalytic core [51514] (8 species)
  7. 571771Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
  8. 571773Domain d1w32b_: 1w32 B: [114121]
    complexed with ca, egl; mutant

Details for d1w32b_

PDB Entry: 1w32 (more details), 1.2 Å

PDB Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus

SCOP Domain Sequences for d1w32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w32b_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssnnytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

SCOP Domain Coordinates for d1w32b_:

Click to download the PDB-style file with coordinates for d1w32b_.
(The format of our PDB-style files is described here.)

Timeline for d1w32b_: