Lineage for d1w30b_ (1w30 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128488Protein Pyrimidine operon regulator PyrR [109612] (4 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 2128504Species Mycobacterium tuberculosis [TaxId:1773] [117672] (1 PDB entry)
    Uniprot P71807
  8. 2128506Domain d1w30b_: 1w30 B: [114119]

Details for d1w30b_

PDB Entry: 1w30 (more details), 1.9 Å

PDB Description: pyrr of mycobacterium tuberculosis as a potential drug target
PDB Compounds: (B:) PyrR bifunctional protein

SCOPe Domain Sequences for d1w30b_:

Sequence, based on SEQRES records: (download)

>d1w30b_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]}
esrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrddlmikpprplastsipaggiddalvilvddvlysgrsvrsa
ldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvi
sr

Sequence, based on observed residues (ATOM records): (download)

>d1w30b_ c.61.1.1 (B:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]}
esrelmsaanvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit
eysgihvghgalditlyrdpprplastsipaggiddalvilvddvlysgrsvrsaldalr
dvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr

SCOPe Domain Coordinates for d1w30b_:

Click to download the PDB-style file with coordinates for d1w30b_.
(The format of our PDB-style files is described here.)

Timeline for d1w30b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w30a_