Lineage for d1w2zb1 (1w2z B:207-647)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309062Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1309063Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1309064Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1309163Species Pea (Pisum sativum) [TaxId:3888] [50002] (2 PDB entries)
    Uniprot Q43077
  8. 1309165Domain d1w2zb1: 1w2z B:207-647 [114109]
    Other proteins in same PDB: d1w2za2, d1w2za3, d1w2zb2, d1w2zb3, d1w2zc2, d1w2zc3, d1w2zd2, d1w2zd3
    complexed with cu, iod, mn, nag, xe

Details for d1w2zb1

PDB Entry: 1w2z (more details), 2.24 Å

PDB Description: psao and xenon
PDB Compounds: (B:) amine oxidase, copper containing

SCOPe Domain Sequences for d1w2zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2zb1 b.30.2.1 (B:207-647) Copper amine oxidase, domain 3 {Pea (Pisum sativum) [TaxId: 3888]}
vskqsppfgpkqhsltshqpqgpgfqinghsvswanwkfhigfdvragivislasiydle
khksrrvlykgyiselfvpyqdpteefyfktffdsgefgfglstvslipnrdcpphaqfi
dtyvhsangtpillknaicvfeqygnimwrhtengipnesieesrtevnlivrtivtvgn
ydnvidwefkasgsikpsialsgileikgtnikhkdeikedlhgklvsansigiyhdhfy
iyyldfdidgthnsfektslktvrikdgsskrksywttetqtaktesdakitiglapael
vvvnpniktavgnevgyrlipaipahpllteddypqirgaftnynvwvtaynrtekwagg
lyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvpaqedfpimpllstsfelrptn
ffernpvlktlsprdvawpgc

SCOPe Domain Coordinates for d1w2zb1:

Click to download the PDB-style file with coordinates for d1w2zb1.
(The format of our PDB-style files is described here.)

Timeline for d1w2zb1: