Lineage for d1w2za3 (1w2z A:99-206)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505045Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2505046Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2505047Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2505242Species Pea (Pisum sativum) [TaxId:3888] [54420] (2 PDB entries)
    Uniprot Q43077
  8. 2505244Domain d1w2za3: 1w2z A:99-206 [114108]
    Other proteins in same PDB: d1w2za1, d1w2zb1, d1w2zc1, d1w2zd1
    complexed with cu, iod, mn, nag, xe

Details for d1w2za3

PDB Entry: 1w2z (more details), 2.24 Å

PDB Description: PSAO and Xenon
PDB Compounds: (A:) amine oxidase, copper containing

SCOPe Domain Sequences for d1w2za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2za3 d.17.2.1 (A:99-206) Copper amine oxidase, domains 1 and 2 {Pea (Pisum sativum) [TaxId: 3888]}
gfpilsvdeqslaiklplkyppfidsvkkrglnlseivcssftmgwfgeeknvrtvrldc
fmkestvniyvrpitgitivadldlmkiveyhdrdieavptaenteyq

SCOPe Domain Coordinates for d1w2za3:

Click to download the PDB-style file with coordinates for d1w2za3.
(The format of our PDB-style files is described here.)

Timeline for d1w2za3: