SCOPe 2.08: Domain d1w2vb_: 1w2v B:

Lineage for d1w2vb_ (1w2v B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
   Uniprot P14768 265-610

8. Domain d1w2vb_: 1w2v B: [114105]
   complexed with ca, edo; mutant

Details for d1w2vb_

PDB Entry: 1w2v, 1.55 Å

PDB Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus

PDB Compounds: (B:) endo-1,4-beta-xylanase a precursor

SCOPe Domain Sequences for d1w2vb_:

Sequence; same for both SEQRES and ATOM records:

>d1w2vb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssneytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

Timeline for d1w2vb_:

• d1w2vb_ first appeared in SCOP 1.71
  
• d1w2vb_ appears in SCOPe 2.07