SCOP 1.71: Domain d1w2va_: 1w2v A:

Lineage for d1w2va_ (1w2v A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

5. Family c.1.8.3: beta-glycanases [51487] (22 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)

8. Domain d1w2va_: 1w2v A: [114104]

Details for d1w2va_

PDB Entry: 1w2v, 1.55 Å

PDB Description: the 3-dimensional structure of a thermostable mutant of a xylanase (xyn10a) from cellvibrio japonicus

SCOP Domain Sequences for d1w2va_:

Sequence; same for both SEQRES and ATOM records:

>d1w2va_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghtlvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssneytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

Timeline for d1w2va_:

• d1w2va_ is new in SCOP 1.71
  
• d1w2va_ appears in SCOP 1.73
  
• d1w2va_ appears in the current release, SCOPe 2.08