SCOPe 2.03: Domain d1w2pb_: 1w2p B:

Lineage for d1w2pb_ (1w2p B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
   Uniprot P14768 265-610

8. Domain d1w2pb_: 1w2p B: [114103]
   complexed with ca, edo

Details for d1w2pb_

PDB Entry: 1w2p, 1.45 Å

PDB Description: the 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus

PDB Compounds: (B:) endo-1,4-beta-xylanase a precursor

SCOPe Domain Sequences for d1w2pb_:

Sequence; same for both SEQRES and ATOM records:

>d1w2pb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

Timeline for d1w2pb_:

• d1w2pb_ first appeared in SCOP 1.71
  
• d1w2pb_ appears in SCOPe 2.02
  
• d1w2pb_ appears in SCOPe 2.04
  
• d1w2pb_ appears in the current release, SCOPe 2.08