Lineage for d1w2pa_ (1w2p A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816176Protein Xylanase A, catalytic core [51514] (8 species)
  7. 816197Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
    Uniprot P14768 265-610
  8. 816200Domain d1w2pa_: 1w2p A: [114102]

Details for d1w2pa_

PDB Entry: 1w2p (more details), 1.45 Å

PDB Description: the 3-dimensional structure of a xylanase (xyn10a) from cellvibrio japonicus
PDB Compounds: (A:) endo-1,4-beta-xylanase a precursor

SCOP Domain Sequences for d1w2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2pa_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

SCOP Domain Coordinates for d1w2pa_:

Click to download the PDB-style file with coordinates for d1w2pa_.
(The format of our PDB-style files is described here.)

Timeline for d1w2pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w2pb_