Lineage for d1w27b_ (1w27 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. Family a.127.1.2: HAL/PAL-like [48572] (3 proteins)
    Pfam PF00221
  6. Protein Phenylalanine ammonia-lyase, PAL [117028] (2 species)
  7. Species Parsley (Petroselinum crispum), PAL1 [TaxId:4043] [117030] (1 PDB entry)
    Uniprot P24481 25-716
  8. Domain d1w27b_: 1w27 B: [114097]
    complexed with dtt

Details for d1w27b_

PDB Entry: 1w27 (more details), 1.7 Å

PDB Description: phenylalanine ammonia-lyase (pal) from petroselinum crispum
PDB Compounds: (B:) phenylalanine ammonia-lyase 1

SCOPe Domain Sequences for d1w27b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w27b_ a.127.1.2 (B:) Phenylalanine ammonia-lyase, PAL {Parsley (Petroselinum crispum), PAL1 [TaxId: 4043]}
edplywgiaaeamtgshldevkkmvaeyrkpvvklggetltisqvaaisardgsgvtvel
seaaragvkassdwvmdsmnkgtdsygvttgfgatshrrtkqggalqkelirflnagifg
ngsdntlphsatraamlvrintllqgysgirfeileaitkflnqnitpclplrgtitasg
dlvplsyiaglltgrpnskavgptgvilspeeafklagveggffelqpkeglalvngtav
gsgmasmvlfeanilavlaevmsaifaevmqgkpeftdhlthklkhhpgqieaaaimehi
ldgsayvkaaqklhemdplqkpkqdryalrtspqwlgpqievirsstkmiereinsvndn
plidvsrnkaihggnfqgtpigvsmdntrlaiaaigklmfaqfselvndfynnglpsnls
ggrnpsldygfkgaeiamasycselqflanpvtnhvqsaeqhnqdvnslglissrktsea
veilklmsttflvglcqaidlrhleenlkstvkntvssvakrvltmgvngelhpsrfcek
dllrvvdreyifayiddpcsatyplmqklrqtlvehalkngdnernlstsifqkiatfed
elkallpkevesaraalesgnpaipnrieecrsyplykfvrkelgteyltgekvtspgee
fekvfiamskgeiidpllecleswngaplpic

SCOPe Domain Coordinates for d1w27b_ are not available.

Timeline for d1w27b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w27a_