Lineage for d1w25b3 (1w25 B:294-454)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561636Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561710Family d.58.29.2: GGDEF domain [117984] (1 protein)
    Pfam PF00990; less decorated than the adenylyl/guanylyl cyclase domain
  6. 2561711Protein Response regulator PleD, C-terminal domain [117985] (1 species)
    Diguanylate cyclase
  7. 2561712Species Caulobacter crescentus [TaxId:155892] [117986] (2 PDB entries)
    Uniprot Q9A5I5
  8. 2561716Domain d1w25b3: 1w25 B:294-454 [114095]
    Other proteins in same PDB: d1w25a1, d1w25a2, d1w25a4, d1w25b1, d1w25b2, d1w25b4
    complexed with c2e, mg, zn

Details for d1w25b3

PDB Entry: 1w25 (more details), 2.7 Å

PDB Description: response regulator pled in complex with c-digmp
PDB Compounds: (B:) stalked-cell differentiation controlling protein

SCOPe Domain Sequences for d1w25b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w25b3 d.58.29.2 (B:294-454) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}
ltglhnrrymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalr
lasnvraidlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvti
sigvsatagegdtpeallkradegvyqakasgrnavvgkaa

SCOPe Domain Coordinates for d1w25b3:

Click to download the PDB-style file with coordinates for d1w25b3.
(The format of our PDB-style files is described here.)

Timeline for d1w25b3: