SCOP 1.75: Domain d1w25b3: 1w25 B:294-455

Lineage for d1w25b3 (1w25 B:294-455)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.2: GGDEF domain [117984] (1 protein)
   Pfam PF00990; less decorated than the adenylyl/guanylyl cyclase domain

6. Protein Response regulator PleD, C-terminal domain [117985] (1 species)
   Diguanylate cyclase

7. Species Caulobacter crescentus [TaxId:155892] [117986] (2 PDB entries)
   Uniprot Q9A5I5

8. Domain d1w25b3: 1w25 B:294-455 [114095]
   Other proteins in same PDB: d1w25a1, d1w25a2, d1w25b1, d1w25b2
   complexed with 5gp, mg, zn

Details for d1w25b3

PDB Entry: 1w25, 2.7 Å

PDB Description: response regulator pled in complex with c-digmp

PDB Compounds: (B:) stalked-cell differentiation controlling protein

SCOP Domain Sequences for d1w25b3:

Sequence; same for both SEQRES and ATOM records:

>d1w25b3 d.58.29.2 (B:294-455) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}
ltglhnrrymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalr
lasnvraidlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvti
sigvsatagegdtpeallkradegvyqakasgrnavvgkaah

Timeline for d1w25b3:

• d1w25b3 first appeared in SCOP 1.71
  
• d1w25b3 appears in SCOP 1.73
  
• d1w25b3 appears in SCOPe 2.01
  
• d1w25b3 appears in the current release, SCOPe 2.08