Lineage for d1w25b3 (1w25 B:294-455)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725665Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 725719Family d.58.29.2: GGDEF domain [117984] (1 protein)
    Pfam PF00990; less decorated than the adenylyl/guanylyl cyclase domain
  6. 725720Protein Response regulator PleD, C-terminal domain [117985] (1 species)
    Diguanylate cyclase
  7. 725721Species Caulobacter crescentus [TaxId:155892] [117986] (1 PDB entry)
  8. 725723Domain d1w25b3: 1w25 B:294-455 [114095]
    Other proteins in same PDB: d1w25a1, d1w25a2, d1w25b1, d1w25b2
    complexed with 5gp, mg, zn

Details for d1w25b3

PDB Entry: 1w25 (more details), 2.7 Å

PDB Description: response regulator pled in complex with c-digmp
PDB Compounds: (B:) stalked-cell differentiation controlling protein

SCOP Domain Sequences for d1w25b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w25b3 d.58.29.2 (B:294-455) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]}
ltglhnrrymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalr
lasnvraidlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvti
sigvsatagegdtpeallkradegvyqakasgrnavvgkaah

SCOP Domain Coordinates for d1w25b3:

Click to download the PDB-style file with coordinates for d1w25b3.
(The format of our PDB-style files is described here.)

Timeline for d1w25b3: