Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.2: GGDEF domain [117984] (1 protein) Pfam PF00990; less decorated than the adenylyl/guanylyl cyclase domain |
Protein Response regulator PleD, C-terminal domain [117985] (1 species) Diguanylate cyclase |
Species Caulobacter crescentus [TaxId:155892] [117986] (2 PDB entries) Uniprot Q9A5I5 |
Domain d1w25b3: 1w25 B:294-454 [114095] Other proteins in same PDB: d1w25a1, d1w25a2, d1w25a4, d1w25b1, d1w25b2, d1w25b4 complexed with c2e, mg, zn |
PDB Entry: 1w25 (more details), 2.7 Å
SCOPe Domain Sequences for d1w25b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w25b3 d.58.29.2 (B:294-454) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]} ltglhnrrymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalr lasnvraidlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvti sigvsatagegdtpeallkradegvyqakasgrnavvgkaa
Timeline for d1w25b3:
View in 3D Domains from other chains: (mouse over for more information) d1w25a1, d1w25a2, d1w25a3, d1w25a4 |