Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein Response regulator PleD, receiver domain [117472] (1 species) duplication: tandem repeat of 2 CheY-like domains |
Species Caulobacter crescentus [TaxId:155892] [117473] (2 PDB entries) Uniprot Q9A5I5 |
Domain d1w25b1: 1w25 B:2-140 [114093] Other proteins in same PDB: d1w25a3, d1w25a4, d1w25b3, d1w25b4 complexed with c2e, mg, zn |
PDB Entry: 1w25 (more details), 2.7 Å
SCOPe Domain Sequences for d1w25b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w25b1 c.23.1.1 (B:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr fklvidelrqreasgrrmg
Timeline for d1w25b1:
View in 3D Domains from other chains: (mouse over for more information) d1w25a1, d1w25a2, d1w25a3, d1w25a4 |