Lineage for d1w25b1 (1w25 B:2-140)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855616Protein Response regulator PleD, receiver domain [117472] (1 species)
    duplication: tandem repeat of 2 CheY-like domains
  7. 2855617Species Caulobacter crescentus [TaxId:155892] [117473] (2 PDB entries)
    Uniprot Q9A5I5
  8. 2855620Domain d1w25b1: 1w25 B:2-140 [114093]
    Other proteins in same PDB: d1w25a3, d1w25a4, d1w25b3, d1w25b4
    complexed with c2e, mg, zn

Details for d1w25b1

PDB Entry: 1w25 (more details), 2.7 Å

PDB Description: response regulator pled in complex with c-digmp
PDB Compounds: (B:) stalked-cell differentiation controlling protein

SCOPe Domain Sequences for d1w25b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w25b1 c.23.1.1 (B:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}
sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
fklvidelrqreasgrrmg

SCOPe Domain Coordinates for d1w25b1:

Click to download the PDB-style file with coordinates for d1w25b1.
(The format of our PDB-style files is described here.)

Timeline for d1w25b1: