Lineage for d1w25a2 (1w25 A:141-293)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578576Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 578577Family c.23.1.1: CheY-related [52173] (18 proteins)
  6. 578710Protein Response regulator PleD, receiver domain [117472] (1 species)
    duplication: tandem repeat of 2 CheY-like domains
  7. 578711Species Caulobacter crescentus [TaxId:155892] [117473] (1 PDB entry)
  8. 578713Domain d1w25a2: 1w25 A:141-293 [114091]
    Other proteins in same PDB: d1w25a3, d1w25b3

Details for d1w25a2

PDB Entry: 1w25 (more details), 2.7 Å

PDB Description: response regulator pled in complex with c-digmp

SCOP Domain Sequences for d1w25a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus}
viagaaarldglggrvlivddnerqaqrvaaelgvehrpviesdpekakisaggpvdlvi
vnaaaknfdglrftaalrseertrqlpvlamvdpddrgrmvkaleigvndilsrpidpqe
lsarvktqiqrkrytdylrnnldhslelavtdq

SCOP Domain Coordinates for d1w25a2:

Click to download the PDB-style file with coordinates for d1w25a2.
(The format of our PDB-style files is described here.)

Timeline for d1w25a2: