Lineage for d1w23a_ (1w23 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589581Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 589696Protein Phosphoserine aminotransferase, PSAT [53426] (3 species)
  7. 589697Species Bacillus alcalophilus [TaxId:1445] [117697] (1 PDB entry)
  8. 589698Domain d1w23a_: 1w23 A: [114088]

Details for d1w23a_

PDB Entry: 1w23 (more details), 1.08 Å

PDB Description: crystal structure of phosphoserine aminotransferase from bacillus alcalophilus

SCOP Domain Sequences for d1w23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus}
vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena

SCOP Domain Coordinates for d1w23a_:

Click to download the PDB-style file with coordinates for d1w23a_.
(The format of our PDB-style files is described here.)

Timeline for d1w23a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w23b_