Lineage for d1w1wf_ (1w1w F:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635844Family a.4.5.57: Rad21/Rec8-like [116795] (1 protein)
    Pfam PF04824
  6. 635845Protein Sister chromatid cohesion protein 1 (SCC1), C-terminal domain [116796] (1 species)
  7. 635846Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116797] (1 PDB entry)
  8. 635848Domain d1w1wf_: 1w1w F: [114085]
    Other proteins in same PDB: d1w1wa_, d1w1wb_, d1w1wc_, d1w1wd_

Details for d1w1wf_

PDB Entry: 1w1w (more details), 2.9 Å

PDB Description: sc smc1hd:scc1-c complex, atpgs
PDB Compounds: (F:) sister chromatid cohesion protein 1

SCOP Domain Sequences for d1w1wf_:

Sequence, based on SEQRES records: (download)

>d1w1wf_ a.4.5.57 (F:) Sister chromatid cohesion protein 1 (SCC1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaivqmakilrkelseekeviftdvlksqantepenitkreasrgffdilslategcigl
sqteafgnikidakpalfe

Sequence, based on observed residues (ATOM records): (download)

>d1w1wf_ a.4.5.57 (F:) Sister chromatid cohesion protein 1 (SCC1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaivqmakilrkelseekeviftdvlksqakreasrgffdilslategciglsqteafgn
ikidakpalfe

SCOP Domain Coordinates for d1w1wf_:

Click to download the PDB-style file with coordinates for d1w1wf_.
(The format of our PDB-style files is described here.)

Timeline for d1w1wf_: