Lineage for d1w1wb_ (1w1w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2113019Protein Smc head domain [52693] (3 species)
  7. 2113020Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117544] (1 PDB entry)
    Uniprot P32908 2-214,1024-1223
  8. 2113022Domain d1w1wb_: 1w1w B: [114081]
    Other proteins in same PDB: d1w1we_, d1w1wf_, d1w1wg_, d1w1wh_
    complexed with ags, mg

Details for d1w1wb_

PDB Entry: 1w1w (more details), 2.9 Å

PDB Description: Sc Smc1hd:Scc1-C complex, ATPgS
PDB Compounds: (B:) structural maintenance of chromosome 1

SCOPe Domain Sequences for d1w1wb_:

Sequence, based on SEQRES records: (download)

>d1w1wb_ c.37.1.12 (B:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsni
lkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyki
dgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykke
yeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevin
neteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelaggn
asltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffvl
devdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensskii
tldlsny

Sequence, based on observed residues (ATOM records): (download)

>d1w1wb_ c.37.1.12 (B:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrslkdliyr
gpqsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknf
lvfqgdveqiaaqspvelsrmfeevsgsiqykkeyeelkekikilnqflkikkkrkelfe
ktfdyvsdhldaiyreltgnasltiededepfnagikyhatpplkrfkdmeylsggektv
aalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivislkntmfe
ksdalvgvyrqqqensskiitldlsny

SCOPe Domain Coordinates for d1w1wb_:

Click to download the PDB-style file with coordinates for d1w1wb_.
(The format of our PDB-style files is described here.)

Timeline for d1w1wb_: