Lineage for d1w1wb_ (1w1w B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. Protein Smc head domain [52693] (3 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117544] (1 PDB entry)
    Uniprot P32908 2-214,1024-1223
  8. Domain d1w1wb_: 1w1w B: [114081]
    Other proteins in same PDB: d1w1we_, d1w1wf_, d1w1wg_, d1w1wh_
    complexed with ags, mg

Details for d1w1wb_

PDB Entry: 1w1w (more details), 2.9 Å

PDB Description: sc smc1hd:scc1-c complex, atpgs
PDB Compounds: (B:) structural maintenance of chromosome 1

SCOPe Domain Sequences for d1w1wb_:

Sequence, based on SEQRES records: (download)

>d1w1wb_ c.37.1.12 (B:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsni
lkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyki
dgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykke
yeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevin
neteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelaggn
asltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffvl
devdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensskii
tldlsny

Sequence, based on observed residues (ATOM records): (download)

>d1w1wb_ c.37.1.12 (B:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrslkdliyr
gpqsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknf
lvfqgdveqiaaqspvelsrmfeevsgsiqykkeyeelkekikilnqflkikkkrkelfe
ktfdyvsdhldaiyreltgnasltiededepfnagikyhatpplkrfkdmeylsggektv
aalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivislkntmfe
ksdalvgvyrqqqensskiitldlsny

SCOPe Domain Coordinates for d1w1wb_ are not available.

Timeline for d1w1wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w1wa_, d1w1wc_, d1w1wd_, d1w1we_, d1w1wf_, d1w1wg_, d1w1wh_