Lineage for d1w1wa_ (1w1w A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697205Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 697374Protein Smc head domain [52693] (3 species)
  7. 697375Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117544] (1 PDB entry)
  8. 697376Domain d1w1wa_: 1w1w A: [114080]
    Other proteins in same PDB: d1w1we_, d1w1wf_, d1w1wg_, d1w1wh_

Details for d1w1wa_

PDB Entry: 1w1w (more details), 2.9 Å

PDB Description: sc smc1hd:scc1-c complex, atpgs
PDB Compounds: (A:) structural maintenance of chromosome 1

SCOP Domain Sequences for d1w1wa_:

Sequence, based on SEQRES records: (download)

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvrsnhlrsni
lkdliyrgvlndensddydnegaassnpqsayvkafyqkgnklvelmriisrngdtsyki
dgktvsykdysiflenenilikaknflvfqgdveqiaaqspvelsrmfeevsgsiqykke
yeelkekieklsksatesiknrrrihgelktykspglevlfqgprgsrydeaegrfevin
neteqlkaeekkilnqflkikkkrkelfektfdyvsdhldaiyreltknpnsnvelaggn
asltiededepfnagikyhatpplkrfkdmeylsggektvaalallfainsyqpspffvl
devdaalditnvqriaayirrhrnpdlqfivislkntmfeksdalvgvyrqqqensskii
tldlsny

Sequence, based on observed residues (ATOM records): (download)

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
grlvglelsnfksyrgvtkvgfgesnftsiigpngsgksnmmdaisfvlgvlkdliyrgp
qsayvkafyqkgnklvelmriisrngdtsykidgktvsykdysiflenenilikaknflv
fqgdveqiaaqspvelsrmftfdyvsdhldaiyreltgnasltkyhatpplkrfkdmeyl
sggektvaalallfainsyqpspffvldevdaalditnvqriaayirrhrnpdlqfivis
lkntmfeksdalvgvyrqqqensskiitldlsny

SCOP Domain Coordinates for d1w1wa_:

Click to download the PDB-style file with coordinates for d1w1wa_.
(The format of our PDB-style files is described here.)

Timeline for d1w1wa_: