Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries) Uniprot O15530 409-550 |
Domain d1w1hb_: 1w1h B: [114077] complexed with gol, so4 |
PDB Entry: 1w1h (more details), 1.45 Å
SCOPe Domain Sequences for d1w1hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1hb_ b.55.1.1 (B:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl mdpsgnahkwcrkiqevwrqryqshpdaavq
Timeline for d1w1hb_: