Lineage for d1w1hb_ (1w1h B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1323359Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1323360Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1323361Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1323362Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)
  7. 1323363Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)
    Uniprot O15530 409-550
  8. 1323365Domain d1w1hb_: 1w1h B: [114077]
    complexed with gol, so4

Details for d1w1hb_

PDB Entry: 1w1h (more details), 1.45 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain
PDB Compounds: (B:) 3-phosphoinositide dependent protein kinase-1

SCOPe Domain Sequences for d1w1hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1hb_ b.55.1.1 (B:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}
gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
mdpsgnahkwcrkiqevwrqryqshpdaavq

SCOPe Domain Coordinates for d1w1hb_:

Click to download the PDB-style file with coordinates for d1w1hb_.
(The format of our PDB-style files is described here.)

Timeline for d1w1hb_: