Lineage for d1w1hb_ (1w1h B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673000Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)
  7. 673001Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)
  8. 673003Domain d1w1hb_: 1w1h B: [114077]

Details for d1w1hb_

PDB Entry: 1w1h (more details), 1.45 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain
PDB Compounds: (B:) 3-phosphoinositide dependent protein kinase-1

SCOP Domain Sequences for d1w1hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1hb_ b.55.1.1 (B:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]}
gplgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdk
rkglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyyl
mdpsgnahkwcrkiqevwrqryqshpdaavq

SCOP Domain Coordinates for d1w1hb_:

Click to download the PDB-style file with coordinates for d1w1hb_.
(The format of our PDB-style files is described here.)

Timeline for d1w1hb_: