![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries) Uniprot O15530 409-550 |
![]() | Domain d1w1ga_: 1w1g A: [114075] complexed with 4pt |
PDB Entry: 1w1g (more details), 1.45 Å
SCOPe Domain Sequences for d1w1ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1ga_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} plgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkr kglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylm dpsgnahkwcrkiqevwrqryqsh
Timeline for d1w1ga_: