SCOP 1.71: Domain d1w1ga_: 1w1g A:

Lineage for d1w1ga_ (1w1g A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
   Pfam 00169

6. Protein 3-phosphoinositide dependent protein kinase-1 [117246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117247] (3 PDB entries)

8. Domain d1w1ga_: 1w1g A: [114075]
   complexed with 4pt

Details for d1w1ga_

PDB Entry: 1w1g, 1.45 Å

PDB Description: crystal structure of the pdk1 pleckstrin homology (ph) domain bound to dic4-phosphatidylinositol (3,4,5)-trisphosphate

SCOP Domain Sequences for d1w1ga_:

Sequence; same for both SEQRES and ATOM records:

>d1w1ga_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens)}
plgsnieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkr
kglfarrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylm
dpsgnahkwcrkiqevwrqryqsh

Timeline for d1w1ga_:

• d1w1ga_ is new in SCOP 1.71
  
• d1w1ga_ appears in SCOP 1.73
  
• d1w1ga_ appears in the current release, SCOPe 2.08, called d1w1ga1