Lineage for d1w0tb_ (1w0t B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 533002Family a.4.1.4: DNA-binding domain of telomeric protein [46745] (2 proteins)
    part of Pfam 00249 (Myb/SANT domain)
  6. 533003Protein DNA-binding domain of human telomeric protein, hTRF1 [46746] (1 species)
  7. 533004Species Human (Homo sapiens) [TaxId:9606] [46747] (4 PDB entries)
  8. 533006Domain d1w0tb_: 1w0t B: [114071]

Details for d1w0tb_

PDB Entry: 1w0t (more details), 2 Å

PDB Description: htrf1 dna-binding domain in complex with telomeric dna.

SCOP Domain Sequences for d1w0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0tb_ a.4.1.4 (B:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens)}
krqawlweedknlrsgvrkygegnwskillhykfnnrtsvmlkdrwrtmkkl

SCOP Domain Coordinates for d1w0tb_:

Click to download the PDB-style file with coordinates for d1w0tb_.
(The format of our PDB-style files is described here.)

Timeline for d1w0tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w0ta_