Lineage for d1w0ib2 (1w0i B:301-461)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711303Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 711304Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 711305Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 711480Protein Beta-ketoacyl-ACP synthase II [53909] (5 species)
  7. 711510Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [117749] (2 PDB entries)
  8. 711518Domain d1w0ib2: 1w0i B:301-461 [114068]
    complexed with k, so4

Details for d1w0ib2

PDB Entry: 1w0i (more details), 2.1 Å

PDB Description: arabidopsis thaliana mitochondrial kas
PDB Compounds: (B:) 3-oxoacyl carrier protein synthase

SCOP Domain Sequences for d1w0ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ib2 c.95.1.1 (B:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]}
yaelcgygmsgdahhitqppedgkgavlamtralrqsglcpnqidyvnahatstpigdav
earaiktvfsehatsgtlafsstkgatghllgaagaveaifsilaihhgvapmtlnvknp
dpifdkrfmplttskkmlvrtamsnsfgfggtnasllfasi

SCOP Domain Coordinates for d1w0ib2:

Click to download the PDB-style file with coordinates for d1w0ib2.
(The format of our PDB-style files is described here.)

Timeline for d1w0ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w0ib1