SCOPe 2.08: Domain d1w0ib2: 1w0i B:301-461

Lineage for d1w0ib2 (1w0i B:301-461)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species)

7. Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [419497] (2 PDB entries)
   Uniprot Q8L3X9

8. Domain d1w0ib2: 1w0i B:301-461 [114068]
   Other proteins in same PDB: d1w0ia1, d1w0ib1
   complexed with k, so4

Details for d1w0ib2

PDB Entry: 1w0i, 2.1 Å

PDB Description: arabidopsis thaliana mitochondrial kas

PDB Compounds: (B:) 3-oxoacyl carrier protein synthase

SCOPe Domain Sequences for d1w0ib2:

Sequence; same for both SEQRES and ATOM records:

>d1w0ib2 c.95.1.1 (B:301-461) Beta-ketoacyl-ACP synthase II, C-terminal domain {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]}
yaelcgygmsgdahhitqppedgkgavlamtralrqsglcpnqidyvnahatstpigdav
earaiktvfsehatsgtlafsstkgatghllgaagaveaifsilaihhgvapmtlnvknp
dpifdkrfmplttskkmlvrtamsnsfgfggtnasllfasi

Timeline for d1w0ib2:

• d1w0ib2 first appeared in SCOP 1.71
  
• d1w0ib2 appears in SCOPe 2.07