Lineage for d1w0ia1 (1w0i A:31-300)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 593923Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 594034Protein Beta-ketoacyl-ACP synthase II [53909] (5 species)
  7. 594054Species Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId:3702] [117749] (1 PDB entry)
  8. 594055Domain d1w0ia1: 1w0i A:31-300 [114065]

Details for d1w0ia1

PDB Entry: 1w0i (more details), 2.1 Å

PDB Description: arabidopsis thaliana mitochondrial kas

SCOP Domain Sequences for d1w0ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ia1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform}
rrvvvtglgmvtplgrgvettwrrlidgecgirgltlddlkmksfdeetklytfdqlssk
vaafvpygsnpgefdealwlnskavanfigyavcaadealrdaewlpteeeekertgvsi
gggigsicdiveaaqlicekrlrrlspffipkilvnmasghvsmkygfqgpnhaavtaca
tgahsigdatrmiqfgdadvmvaggtessidalsvagfsrsralstkfnsspqeasrpfd
cdrdgfvigegsgvivleeyehakrrgaki

SCOP Domain Coordinates for d1w0ia1:

Click to download the PDB-style file with coordinates for d1w0ia1.
(The format of our PDB-style files is described here.)

Timeline for d1w0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w0ia2