![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease ERI1 [117648] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117649] (1 PDB entry) Uniprot Q8IV48 122-321 |
![]() | Domain d1w0ha_: 1w0h A: [114064] complexed with amp, mg |
PDB Entry: 1w0h (more details), 1.59 Å
SCOPe Domain Sequences for d1w0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]} adsyydyiciidfeatceegnppefvheiiefpvvllnthtleiedtfqqyvrpeintql sdfcisltgitqdqvdradtfpqvlkkvidwmklkelgtkykyslltdgswdmskflniq cqlsrlkyppfakkwinirksygnfykvprsqtkltimleklgmdydgrphcglddskni ariavrmlqdgcelrinekm
Timeline for d1w0ha_: