Lineage for d1w0ha_ (1w0h A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886795Protein Exonuclease ERI1 [117648] (1 species)
  7. 2886796Species Human (Homo sapiens) [TaxId:9606] [117649] (1 PDB entry)
    Uniprot Q8IV48 122-321
  8. 2886797Domain d1w0ha_: 1w0h A: [114064]
    complexed with amp, mg

Details for d1w0ha_

PDB Entry: 1w0h (more details), 1.59 Å

PDB Description: crystallographic structure of the nuclease domain of 3'hexo, a deddh family member, bound to ramp
PDB Compounds: (A:) 3'-5' exonuclease eri1

SCOPe Domain Sequences for d1w0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]}
adsyydyiciidfeatceegnppefvheiiefpvvllnthtleiedtfqqyvrpeintql
sdfcisltgitqdqvdradtfpqvlkkvidwmklkelgtkykyslltdgswdmskflniq
cqlsrlkyppfakkwinirksygnfykvprsqtkltimleklgmdydgrphcglddskni
ariavrmlqdgcelrinekm

SCOPe Domain Coordinates for d1w0ha_:

Click to download the PDB-style file with coordinates for d1w0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1w0ha_: