Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [117725] (2 PDB entries) Uniprot P95313 |
Domain d1w0dc1: 1w0d C:1A-336 [114062] Other proteins in same PDB: d1w0da2, d1w0db2, d1w0dc2, d1w0dd2 complexed with so4 |
PDB Entry: 1w0d (more details), 1.65 Å
SCOPe Domain Sequences for d1w0dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0dc1 c.77.1.1 (C:1A-336) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]} sklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrnh daillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvvv regtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhktn vltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitdl aaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlge hdaaarvdraveahlatrgserlatsdvgeriaaal
Timeline for d1w0dc1: