SCOP 1.71: Domain d1w0dc_: 1w0d C:

Lineage for d1w0dc_ (1w0d C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [117725] (1 PDB entry)

8. Domain d1w0dc_: 1w0d C: [114062]

Details for d1w0dc_

PDB Entry: 1w0d, 1.65 Å

PDB Description: the high resolution structure of mycobacterium tuberculosis leub (rv2995c)

SCOP Domain Sequences for d1w0dc_:

Sequence; same for both SEQRES and ATOM records:

>d1w0dc_ c.77.1.1 (C:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis}
msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
ehdaaarvdraveahlatrgserlatsdvgeriaaal

Timeline for d1w0dc_:

• d1w0dc_ is new in SCOP 1.71
  
• d1w0dc_ appears in SCOP 1.73
  
• d1w0dc_ appears in the current release, SCOPe 2.08, called d1w0dc1