Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species) |
Species Leishmania major [TaxId:5664] [63926] (14 PDB entries) Uniprot Q01782 |
Domain d1w0cf_: 1w0c F: [114057] complexed with nap, taq |
PDB Entry: 1w0c (more details), 2.6 Å
SCOPe Domain Sequences for d1w0cf_:
Sequence, based on SEQRES records: (download)
>d1w0cf_ c.2.1.2 (F:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
>d1w0cf_ c.2.1.2 (F:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa dlsnvatapsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndgdreamet atadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmak galegltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevs dvviflcsskakyitgtcvkvdggysltra
Timeline for d1w0cf_: