Lineage for d1w0cb_ (1w0c B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574451Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 574630Protein Dihydropteridin reductase (pteridine reductase) [51769] (6 species)
  7. 574633Species Leishmania major [TaxId:5664] [63926] (3 PDB entries)
  8. 574641Domain d1w0cb_: 1w0c B: [114053]

Details for d1w0cb_

PDB Entry: 1w0c (more details), 2.6 Å

PDB Description: inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.

SCOP Domain Sequences for d1w0cb_:

Sequence, based on SEQRES records: (download)

>d1w0cb_ c.2.1.2 (B:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1w0cb_ c.2.1.2 (B:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrgdre
ametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiy
tmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssa
aevsdvviflcsskakyitgtcvkvdggysltra

SCOP Domain Coordinates for d1w0cb_:

Click to download the PDB-style file with coordinates for d1w0cb_.
(The format of our PDB-style files is described here.)

Timeline for d1w0cb_: