SCOP 1.73: Domain d1w07a1: 1w07 A:273-461

Lineage for d1w07a1 (1w07 A:273-461)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.2: acyl-CoA oxidase C-terminal domains [74714] (2 proteins)
   duplication: tandem repeat of this fold

6. Protein Acyl-coenzyme A oxidase 1, domains 3 and 4 [116885] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116886] (1 PDB entry)

8. Domain d1w07a1: 1w07 A:273-461 [114046]
   Other proteins in same PDB: d1w07a3, d1w07b3

Details for d1w07a1

PDB Entry: 1w07, 2 Å

PDB Description: arabidopsis thaliana acyl-coa oxidase 1

PDB Compounds: (A:) acyl-CoA oxidase

SCOP Domain Sequences for d1w07a1:

Sequence, based on SEQRES records:

>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkqlvygtmvyvrqtivadasnalsravciatrysavrrqfgahnggietqvidyktqqn
rlfpllasayafrfvgewlkwlytdvterlaasdfatlpeahactaglksltttatadgi
eecrklcgghgylwcsglpelfavyvpactyegdnvvlqlqvarflmktvaqlgsgkvpv
gttaymgra

Sequence, based on observed residues (ATOM records):

>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pkqlvygtmvyvrqtivadasnalsravciatrysavrrqfgagietqvidyktqqnrlf
pllasayafrfvgewlkwlytdvterlaasdfatlpeahactaglksltttatadgieec
rklcgghgylwcsglpelfavyvpactyegdnvvlqlqvarflmktvaqlgsgkvpvgtt
aymgra

Timeline for d1w07a1:

• d1w07a1 first appeared in SCOP 1.71
  
• d1w07a1 appears in SCOP 1.75
  
• d1w07a1 appears in the current release, SCOPe 2.08