![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.81: HSP33 redox switch-like [118351] (1 superfamily) alpha+beta zinc-binding domain; alpha(2)-beta(2)-alpha |
![]() | Superfamily g.81.1: HSP33 redox switch-like [118352] (1 family) ![]() |
![]() | Family g.81.1.1: HSP33 redox switch-like [118353] (1 protein) |
![]() | Protein HSP33, C-terminal domain [118354] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [118356] (1 PDB entry) Uniprot P37565 |
![]() | Domain d1vzyb2: 1vzy B:234-286 [114045] Other proteins in same PDB: d1vzya1, d1vzyb1 complexed with act, zn |
PDB Entry: 1vzy (more details), 1.97 Å
SCOPe Domain Sequences for d1vzyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vzyb2 g.81.1.1 (B:234-286) HSP33, C-terminal domain {Bacillus subtilis [TaxId: 1423]} hcpcskerfetailglgkkeiqdmieedgqaeavchfcnekylftkeeleglr
Timeline for d1vzyb2: