Lineage for d1vz5c_ (1vz5 C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677749Family b.82.2.5: TauD/TfdA-like [75038] (2 proteins)
  6. 677750Protein Putative alkylsulfatase AtsK [101989] (1 species)
  7. 677751Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries)
  8. 677764Domain d1vz5c_: 1vz5 C: [114038]

Details for d1vz5c_

PDB Entry: 1vz5 (more details), 2.15 Å

PDB Description: succinate complex of atsk
PDB Compounds: (C:) putative alkylsulfatase atsk

SCOP Domain Sequences for d1vz5c_:

Sequence, based on SEQRES records: (download)

>d1vz5c_ b.82.2.5 (C:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg
gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy
etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag
dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr

Sequence, based on observed residues (ATOM records): (download)

>d1vz5c_ b.82.2.5 (C:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvryllqlranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpe
plreladklwavhsneyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlq
ghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqls
rttr

SCOP Domain Coordinates for d1vz5c_:

Click to download the PDB-style file with coordinates for d1vz5c_.
(The format of our PDB-style files is described here.)

Timeline for d1vz5c_: