Lineage for d1vz5b_ (1vz5 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567527Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 567589Family b.82.2.5: TauD/TfdA-like [75038] (2 proteins)
  6. 567590Protein Putative alkylsulfatase AtsK [101989] (1 species)
  7. 567591Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries)
  8. 567609Domain d1vz5b_: 1vz5 B: [114037]

Details for d1vz5b_

PDB Entry: 1vz5 (more details), 2.15 Å

PDB Description: succinate complex of atsk

SCOP Domain Sequences for d1vz5b_:

Sequence, based on SEQRES records: (download)

>d1vz5b_ b.82.2.5 (B:) Putative alkylsulfatase AtsK {Pseudomonas putida}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg
gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy
etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag
dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttrk

Sequence, based on observed residues (ATOM records): (download)

>d1vz5b_ b.82.2.5 (B:) Putative alkylsulfatase AtsK {Pseudomonas putida}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvapvvdgtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwanta
aayqelpeplreladklwavhsnevyetehpvvrvhpisgeralqlghfvkrikgyslad
sqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagev
pvgvdgqlsrttrk

SCOP Domain Coordinates for d1vz5b_:

Click to download the PDB-style file with coordinates for d1vz5b_.
(The format of our PDB-style files is described here.)

Timeline for d1vz5b_: